Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Hps3 Peptide - N-terminal region

Hps3 Peptide - N-terminal region

Product Specifications

Product Name Alternative

Hps3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Hps3 Rabbit Polyclonal Antibody (orb329564) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001101134

Preservative

Lyophilized powder

AA Sequence

LSRQRCTFSTLGRVLRMAYSEAGDYLVAIEEKNKTVFLRAYVNWRSKRND

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PIGH (N-term) Rabbit Polyclonal Antibody
AP53296PU-N 400 µL

PIGH (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PDLIM4 Polyclonal Antibody
E-AB-11541-01 20 µL

PDLIM4 Polyclonal Antibody

Sign In for Pricing
View Details
PDLIM4 Polyclonal Antibody
E-AB-11541-02 60 µL

PDLIM4 Polyclonal Antibody

Sign In for Pricing
View Details
PDLIM4 Polyclonal Antibody
E-AB-11541-03 120 µL

PDLIM4 Polyclonal Antibody

Sign In for Pricing
View Details
PDLIM4 Polyclonal Antibody
E-AB-11541-04 200 µL

PDLIM4 Polyclonal Antibody

Sign In for Pricing
View Details
Normedazepam
TRC-N169470-50MG 50 mg

Normedazepam

Sign In for Pricing
View Details