Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Hps3 Peptide - N-terminal region

Hps3 Peptide - N-terminal region

Product Specifications

Product Name Alternative

Hps3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Hps3 Rabbit Polyclonal Antibody (orb329564) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001101134

Preservative

Lyophilized powder

AA Sequence

LSRQRCTFSTLGRVLRMAYSEAGDYLVAIEEKNKTVFLRAYVNWRSKRND

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRIM37 Human Gene Knockout Kit (CRISPR)
KN205948BN 1 Kit

TRIM37 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant Glucocorticoid Receptor Monoclonal Antibody
E-AB-81561-01 50 µL

Recombinant Glucocorticoid Receptor Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant Glucocorticoid Receptor Monoclonal Antibody
E-AB-81561-02 100 µL

Recombinant Glucocorticoid Receptor Monoclonal Antibody

Sign In for Pricing
View Details
GelGreen® Nucleic Acid Gel Stain, 10, 000X in Water
#41005 1x 500 µL

GelGreen® Nucleic Acid Gel Stain, 10, 000X in Water

Sign In for Pricing
View Details
Dichloroacetic anhydride
TRC-D189760-500MG 500 mg

Dichloroacetic anhydride

Sign In for Pricing
View Details
Human ZNF619 activation kit by CRISPRa
GA117206 1 Kit

Human ZNF619 activation kit by CRISPRa

Sign In for Pricing
View Details