Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HPSE Peptide - N-terminal region

HPSE Peptide - N-terminal region

Product Specifications

Product Name Alternative

HPA, HPR1, HPSE1, HSE1, HPA1

UniProt

Q9Y251

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with HPSE Rabbit Polyclonal Antibody (orb584788) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_006656

Preservative

Lyophilized powder

AA Sequence

KLRLEWPYQEQLLLREHYQKKFKNSTYSRSSVDVLYTFANCSGLDLIFGL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FITC-Labeled Human NCAM-1 / CD56 Protein, His Tag
NC1-HF2H5-25ug 25 µg

FITC-Labeled Human NCAM-1 / CD56 Protein, His Tag

Sign In for Pricing
View Details
Goat Nucleophosmin ELISA Kit
MBS101769 Inquire

Goat Nucleophosmin ELISA Kit

Sign In for Pricing
View Details
FAAP100 (G-10)
sc-514598 200 µg/mL

FAAP100 (G-10)

Sign In for Pricing
View Details
GIOT1 Polyclonal Antibody, APC-Cy5.5 Conjugated
bs-11406R-APC-Cy5.5 100 µL

GIOT1 Polyclonal Antibody, APC-Cy5.5 Conjugated

Sign In for Pricing
View Details
Multiplex Assay Kit for Mothers Against Decapentaplegic Homolog 7 (Smad7), etc. by FLIA (Flow Luminescence Immunoassay)
TRV-0026711 96 Tests

Multiplex Assay Kit for Mothers Against Decapentaplegic Homolog 7 (Smad7), etc. by FLIA (Flow Luminescence Immunoassay)

Sign In for Pricing
View Details
Human FPRL2/FPR3 Alexa Fluor 350 Antibody (Clone 374822)
FAB3896U-100UG 100 µg

Human FPRL2/FPR3 Alexa Fluor 350 Antibody (Clone 374822)

Sign In for Pricing
View Details