Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RIDA Peptide - N-terminal region

RIDA Peptide - N-terminal region

Product Specifications

Product Name Alternative

PSP, P14.5, UK114, HRSP12, hp14.5

UniProt

P52758

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RIDA Rabbit Polyclonal Antibody (orb581580) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_005827

Preservative

Lyophilized powder

AA Sequence

MSSLIRRVISTAKAPGAIGPYSQAVLVDRTIYISGQIGMDPSSGQLVSGG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Solusol (Haz Fee)
LS-311 450 mL

Solusol (Haz Fee)

Sign In for Pricing
View Details
GAS1 Human Gene Knockout Kit (CRISPR)
KN224804LP 1 Kit

GAS1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Ep-CAM / CD326 (VU-1D9), CF405S conjugate, 0.1mg/mL
BNC040017-500 1x 500 µL

Ep-CAM / CD326 (VU-1D9), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TBX10 Antibody
8C10164-AAT 50 µg

TBX10 Antibody

Sign In for Pricing
View Details
Parvalbumin (PVALB) (NM_002854) Human Over-expression Lysate
LY419082 100 µg

Parvalbumin (PVALB) (NM_002854) Human Over-expression Lysate

Sign In for Pricing
View Details
Diosmetin-d3
TRC-D485002-5MG 5 mg

Diosmetin-d3

Sign In for Pricing
View Details