Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Hsd17b11 Peptide - middle region

Hsd17b11 Peptide - middle region

Product Specifications

Product Name Alternative

Dhrs8, Pan1b, SDR2, retSDR2

UniProt

Q9EQ06

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Hsd17b11 Rabbit Polyclonal Antibody (orb577799) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_444492

Preservative

Lyophilized powder

AA Sequence

IYSAAKKVKEEVGDVSILVNNAGVVYTADLFATQDPQIEKTFEVNVLAHF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human QSOX1 Protein, His Tag
MBS189113-01 0.01 mg

Human QSOX1 Protein, His Tag

Sign In for Pricing
View Details
Human QSOX1 Protein, His Tag
MBS189113-02 0.05 mg

Human QSOX1 Protein, His Tag

Sign In for Pricing
View Details
Human QSOX1 Protein, His Tag
MBS189113-03 0.1 mg

Human QSOX1 Protein, His Tag

Sign In for Pricing
View Details
Human QSOX1 Protein, His Tag
MBS189113-04 5x 0.1 mg

Human QSOX1 Protein, His Tag

Sign In for Pricing
View Details
Pasireotide (diaspartate)
orb1982174-01 5 mg

Pasireotide (diaspartate)

Sign In for Pricing
View Details
Pasireotide (diaspartate)
orb1982174-02 50 mg

Pasireotide (diaspartate)

Sign In for Pricing
View Details