Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HSD17B7 Peptide - middle region

HSD17B7 Peptide - middle region

Product Specifications

Product Name Alternative

MGC12523, MGC75018, PRAP, SDR37C1

UniProt

P56937

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with HSD17B7 Rabbit Polyclonal Antibody (orb585130) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_057455

Preservative

Lyophilized powder

AA Sequence

SDNPSQLIWTSSRSARKSNFSLEDFQHSKGKEPYSSSKYATDLLSVALNR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Capn2 (NM_009794) Mouse Recombinant Protein
TP510127 20 µg

Capn2 (NM_009794) Mouse Recombinant Protein

Sign In for Pricing
View Details
MAML1 Rabbit Polyclonal Antibody
TA362734 100 µL

MAML1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Rad6 (UBE2A) Rabbit Polyclonal Antibody
TA363797 100 µL

Rad6 (UBE2A) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Mouse Cd5 activation kit by CRISPRa
GA200628 1 Kit

Mouse Cd5 activation kit by CRISPRa

Sign In for Pricing
View Details
4-Octylphenol
TRC-O293775-1G 1 g

4-Octylphenol

Sign In for Pricing
View Details
Human IgM (Immunoglobulin Mu Heavy Chain) (B-Cell Marker) (rIM373), CF647 conjugate, 0.1mg/mL
BNC472560-500 1x 500 µL

Human IgM (Immunoglobulin Mu Heavy Chain) (B-Cell Marker) (rIM373), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details