Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HSD17B7 Peptide - middle region

HSD17B7 Peptide - middle region

Product Specifications

Product Name Alternative

MGC12523, MGC75018, PRAP, SDR37C1

UniProt

P56937

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with HSD17B7 Rabbit Polyclonal Antibody (orb585130) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_057455

Preservative

Lyophilized powder

AA Sequence

SDNPSQLIWTSSRSARKSNFSLEDFQHSKGKEPYSSSKYATDLLSVALNR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Spectrin Alpha 1 (Erythrocyte Marker) (SPTA1/2939R), CF740 conjugate, 0.1mg/mL
BNC742939-100 1x 100 µL

Spectrin Alpha 1 (Erythrocyte Marker) (SPTA1/2939R), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SMAP (C11orf58) (NM_014267) Human Recombinant Protein
TP303329L 1 mg

SMAP (C11orf58) (NM_014267) Human Recombinant Protein

Sign In for Pricing
View Details
FLII Antibody
KC-46259-01 50 μL

FLII Antibody

Sign In for Pricing
View Details
FLII Antibody
KC-46259-02 100 µL

FLII Antibody

Sign In for Pricing
View Details
FLII Antibody
KC-46259-03 1 mL

FLII Antibody

Sign In for Pricing
View Details
Human FNBP1L activation kit by CRISPRa
GA110331 1 Kit

Human FNBP1L activation kit by CRISPRa

Sign In for Pricing
View Details