Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HSD17B8 Peptide - N-terminal region

HSD17B8 Peptide - N-terminal region

Product Specifications

Product Name Alternative

D6S2245E, FABG, FABGL, H2-KE6, HKE6, KE6, RING2, SDR30C1, dJ1033B10.9

UniProt

Q92506

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with HSD17B8 Rabbit Polyclonal Antibody (orb585235) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_055049

Preservative

Lyophilized powder

AA Sequence

TVRLLGGPGSKEGPPRGNHAAFQADVSEARAARCLLEQVQACFSRPPSVV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ReadiLeave™ Reversible Biotin Succinimidyl Ester
3400-AAT 1 mg

ReadiLeave™ Reversible Biotin Succinimidyl Ester

Sign In for Pricing
View Details
2-Phenylpropionitrile
TRC-P336200-25G 25 g

2-Phenylpropionitrile

Sign In for Pricing
View Details
Frozen Tissue Blocks, Pleura
CB501798 1 Block

Frozen Tissue Blocks, Pleura

Sign In for Pricing
View Details
PTau181 Antibody
KC-2341-01 50 μL

PTau181 Antibody

Sign In for Pricing
View Details
PTau181 Antibody
KC-2341-02 100 µL

PTau181 Antibody

Sign In for Pricing
View Details
PTau181 Antibody
KC-2341-03 1 mL

PTau181 Antibody

Sign In for Pricing
View Details