Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HSD3B7 Peptide - middle region

HSD3B7 Peptide - middle region

Product Specifications

Product Name Alternative

PFIC4, CBAS1, SDR11E3

UniProt

Q9H2F3

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with HSD3B7 Rabbit Polyclonal Antibody (orb580923) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_079469

Preservative

Lyophilized powder

AA Sequence

QGTRNVIEACVQTGTRFLVYTSSMEVVGPNTKGHPFYRGNEDTPYEAVHR

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phaseollin
E7968-1mg 1 mg

Phaseollin

Sign In for Pricing
View Details
CD248 Polyclonal Antibody
RD265954A-01 60 μL

CD248 Polyclonal Antibody

Sign In for Pricing
View Details
CD248 Polyclonal Antibody
RD265954A-02 120 μL

CD248 Polyclonal Antibody

Sign In for Pricing
View Details
CD248 Polyclonal Antibody
RD265954A-03 200 µL

CD248 Polyclonal Antibody

Sign In for Pricing
View Details
MMP14 (Matrix Metalloproteinase 14, MMP-14, MMP-X1, MT-MMP, MT1MMP, MTMMP1, WNCHRS, MT1-MMP, MT-MMP 1) (FITC)
MBS6426917-01 0.1 mL

MMP14 (Matrix Metalloproteinase 14, MMP-14, MMP-X1, MT-MMP, MT1MMP, MTMMP1, WNCHRS, MT1-MMP, MT-MMP 1) (FITC)

Sign In for Pricing
View Details
MMP14 (Matrix Metalloproteinase 14, MMP-14, MMP-X1, MT-MMP, MT1MMP, MTMMP1, WNCHRS, MT1-MMP, MT-MMP 1) (FITC)
MBS6426917-02 5x 0.1 mL

MMP14 (Matrix Metalloproteinase 14, MMP-14, MMP-X1, MT-MMP, MT1MMP, MTMMP1, WNCHRS, MT1-MMP, MT-MMP 1) (FITC)

Sign In for Pricing
View Details