Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HSD3B7 Peptide - middle region

HSD3B7 Peptide - middle region

Product Specifications

Product Name Alternative

PFIC4, CBAS1, SDR11E3

UniProt

Q9H2F3

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with HSD3B7 Rabbit Polyclonal Antibody (orb580923) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_079469

Preservative

Lyophilized powder

AA Sequence

QGTRNVIEACVQTGTRFLVYTSSMEVVGPNTKGHPFYRGNEDTPYEAVHR

More Discoveries

Explore Other Products

Browse additional items from our catalog

Habp4 (NM_019986) Mouse Tagged ORF Clone
MG216950 10 µg

Habp4 (NM_019986) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Micrewtube 0.5ml SS Dark Brown
T3412TBR 1000 / PCK

Micrewtube 0.5ml SS Dark Brown

Sign In for Pricing
View Details
STARD13 Human Over-expression Lysate
orb1354354 100 µg

STARD13 Human Over-expression Lysate

Sign In for Pricing
View Details
PSMD9 293 Cell Lysate
408926 0.1 mg

PSMD9 293 Cell Lysate

Sign In for Pricing
View Details
LTK (h) -PR
sc-40085-PR 10 µM - 20 µL

LTK (h) -PR

Sign In for Pricing
View Details
Human NHERF2 Control/blocking peptide #1
NHERF21-P 100 µg

Human NHERF2 Control/blocking peptide #1

Sign In for Pricing
View Details