Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HSDL1 Peptide - C-terminal region

HSDL1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

MGC125994, MGC125995, MGC126032, SDR12C3

UniProt

Q3SXM5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with HSDL1 Rabbit Polyclonal Antibody (orb584744) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_113651

Preservative

Lyophilized powder

AA Sequence

STLGISKRTTGYWSHSIQFLFAQYMPEWLWVWGANILNRSLRKEALSCTA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ALPK1 Overexpression Lysate (Native) - (Dry Ice)
NBL1-07486 0.1 mg

ALPK1 Overexpression Lysate (Native) - (Dry Ice)

Sign In for Pricing
View Details
PARP8, ID (PARP8, Poly [ADP-ribose] polymerase 8, ADP-ribosyltransferase diphtheria toxin-like 16) (MaxLight 490) discontinued
039683-ML490 100 µL

PARP8, ID (PARP8, Poly [ADP-ribose] polymerase 8, ADP-ribosyltransferase diphtheria toxin-like 16) (MaxLight 490) discontinued

Sign In for Pricing
View Details
GATA2 3'UTR Luciferase Stable Cell Line
TU008631 1.0 mL

GATA2 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
MCP-3 / CCL7 Protein (His Tag)
600-044-L50 50 µg

MCP-3 / CCL7 Protein (His Tag)

Sign In for Pricing
View Details
GNRHR Antibody
orb1555111-01 50 μL

GNRHR Antibody

Sign In for Pricing
View Details
GNRHR Antibody
orb1555111-02 100 µL

GNRHR Antibody

Sign In for Pricing
View Details