Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HSDL1 Peptide - C-terminal region

HSDL1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

MGC125994, MGC125995, MGC126032, SDR12C3

UniProt

Q3SXM5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with HSDL1 Rabbit Polyclonal Antibody (orb584744) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_113651

Preservative

Lyophilized powder

AA Sequence

STLGISKRTTGYWSHSIQFLFAQYMPEWLWVWGANILNRSLRKEALSCTA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TSH3 Antibody
44481-01 50 µL

TSH3 Antibody

Sign In for Pricing
View Details
TSH3 Antibody
44481-02 100 µL

TSH3 Antibody

Sign In for Pricing
View Details
Recombinant Bacillus subtilis Fructose permease IID component (levG)
orb2916460-01 20 µg

Recombinant Bacillus subtilis Fructose permease IID component (levG)

Sign In for Pricing
View Details
Recombinant Bacillus subtilis Fructose permease IID component (levG)
orb2916460-02 100 µg

Recombinant Bacillus subtilis Fructose permease IID component (levG)

Sign In for Pricing
View Details
Rabbit Anti-Human IgG(H+L)-HRP
LF-SA8006 1.0 ml

Rabbit Anti-Human IgG(H+L)-HRP

Sign In for Pricing
View Details
GGNBP1 Polyclonal Antibody, RBITC Conjugated
bs-12266R-RBITC 100 µL

GGNBP1 Polyclonal Antibody, RBITC Conjugated

Sign In for Pricing
View Details