Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HSF2 Peptide - N-terminal region

HSF2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

MGC117376, MGC156196, MGC75048, HSF 2, HSTF 2

UniProt

Q03933

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with HSF2 Rabbit Polyclonal Antibody (orb573726) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001129036

Preservative

Lyophilized powder

AA Sequence

ILPKYFKHNNMASFVRQLNMYGFRKVVHIDSGIVKQERDGPVEFQHPYFK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

p-Cresol-d7
TRC-C781902-10MG 10 mg

p-Cresol-d7

Sign In for Pricing
View Details
PE/Cyanine7 Rat IgG2a, κ Isotype Control[2A3]
E-AB-F09832H-01 20 Tests

PE/Cyanine7 Rat IgG2a, κ Isotype Control[2A3]

Sign In for Pricing
View Details
PE/Cyanine7 Rat IgG2a, κ Isotype Control[2A3]
E-AB-F09832H-02 100 Tests

PE/Cyanine7 Rat IgG2a, κ Isotype Control[2A3]

Sign In for Pricing
View Details
PE/Cyanine7 Rat IgG2a, κ Isotype Control[2A3]
E-AB-F09832H-03 2x 100 Tests

PE/Cyanine7 Rat IgG2a, κ Isotype Control[2A3]

Sign In for Pricing
View Details
Zfp428 (NM_146183) Mouse Tagged ORF Clone
MG201536 10 µg

Zfp428 (NM_146183) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Zhx1 Mouse Gene Knockout Kit (CRISPR)
KN520080 1 Kit

Zhx1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details