Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HSF2 Peptide - N-terminal region

HSF2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

MGC117376, MGC156196, MGC75048, HSF 2, HSTF 2

UniProt

Q03933

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with HSF2 Rabbit Polyclonal Antibody (orb573726) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001129036

Preservative

Lyophilized powder

AA Sequence

ILPKYFKHNNMASFVRQLNMYGFRKVVHIDSGIVKQERDGPVEFQHPYFK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD44v6 (Marker of Tumor Metastasis) (CD44V6/2496), CF568 conjugate, 0.1mg/mL
BNC682496-100 1x 100 µL

CD44v6 (Marker of Tumor Metastasis) (CD44V6/2496), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ATF4 Recombinant Rabbit Monoclonal Antibody [SD20-92]
ET1612-37 100 µL

ATF4 Recombinant Rabbit Monoclonal Antibody [SD20-92]

Sign In for Pricing
View Details
PON2 Rabbit Polyclonal Antibody
TA360987 100 µL

PON2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Mouse Nmt2 activation kit by CRISPRa
GA202922 1 Kit

Mouse Nmt2 activation kit by CRISPRa

Sign In for Pricing
View Details
N-Cyclohexylbenzo[d]thiazole-2-sulfonamide
TRC-C992305-250MG 250 mg

N-Cyclohexylbenzo[d]thiazole-2-sulfonamide

Sign In for Pricing
View Details
Tissue FFPE Sections, Ovary: left
CS802742 5x 5 µm

Tissue FFPE Sections, Ovary: left

Sign In for Pricing
View Details