Hspb7 Peptide - middle region
Hspb7 Peptide - middle region
Product Specifications
Product Name Alternative
27kDa, Hsp25-2, MGC107591, cvHsp
UniProt
P35385
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Hspb7 Rabbit Polyclonal Antibody (orb578132) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_038896
Preservative
Lyophilized powder
AA Sequence
FGSFMLPHSEPLAFPARPGGQGNIKTLGDAYEFTVDMRDFSPEDIIVTTF
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
PKSH030278 100 µg
Recombinant Human IL-8/CXCL8 Protein (aa 28-99, Fc Tag)
Sign In for Pricing
View Details 
TP720364M 50 µg
Apolipoprotein H (APOH) (NM_000042) Human Recombinant Protein
Sign In for Pricing
View Details 
LY424720 100 µg
Neuraminidase (NEU1) (NM_000434) Human Over-expression Lysate
Sign In for Pricing
View Details 
