Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Hspb7 Peptide - middle region

Hspb7 Peptide - middle region

Product Specifications

Product Name Alternative

27kDa, Hsp25-2, MGC107591, cvHsp

UniProt

P35385

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Hspb7 Rabbit Polyclonal Antibody (orb578132) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_038896

Preservative

Lyophilized powder

AA Sequence

FGSFMLPHSEPLAFPARPGGQGNIKTLGDAYEFTVDMRDFSPEDIIVTTF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Parkin (PARK2) Rabbit Polyclonal Antibody
AP06437PU-N 100 µg

Parkin (PARK2) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
TAFA1 Antibody
KC-17649-01 50 μL

TAFA1 Antibody

Sign In for Pricing
View Details
TAFA1 Antibody
KC-17649-02 100 µL

TAFA1 Antibody

Sign In for Pricing
View Details
TAFA1 Antibody
KC-17649-03 1 mL

TAFA1 Antibody

Sign In for Pricing
View Details
Human ZDHHC9 activation kit by CRISPRa
GA109577 1 Kit

Human ZDHHC9 activation kit by CRISPRa

Sign In for Pricing
View Details
RNH1 Antibody
KC-31932-01 50 μL

RNH1 Antibody

Sign In for Pricing
View Details