Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Hspb7 Peptide - C-terminal region

Hspb7 Peptide - C-terminal region

Product Specifications

Product Name Alternative

27kDa, Hsp25-2, MGC107591, cvHsp

UniProt

P35385

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Hspb7 Rabbit Polyclonal Antibody (orb578133) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_038896

Preservative

Lyophilized powder

AA Sequence

TFAHKCQLPEDVDPTSVTSALREDGSLTIRARRNPHTEHVQQTFRTEIKI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GANC Rabbit Polyclonal Antibody
TA368355 100 µL

GANC Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
C6orf132 Antibody
KC-3583-01 50 μL

C6orf132 Antibody

Sign In for Pricing
View Details
C6orf132 Antibody
KC-3583-02 100 µL

C6orf132 Antibody

Sign In for Pricing
View Details
C6orf132 Antibody
KC-3583-03 1 mL

C6orf132 Antibody

Sign In for Pricing
View Details
Human Ornithine Decarboxylase Antizyme 1 (OAZ1) ELISA Kit
RD-OAZ1-Hu-01 96 Tests

Human Ornithine Decarboxylase Antizyme 1 (OAZ1) ELISA Kit

Sign In for Pricing
View Details
Human Ornithine Decarboxylase Antizyme 1 (OAZ1) ELISA Kit
RD-OAZ1-Hu-02 48 Tests

Human Ornithine Decarboxylase Antizyme 1 (OAZ1) ELISA Kit

Sign In for Pricing
View Details