Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Hspb7 Peptide - C-terminal region

Hspb7 Peptide - C-terminal region

Product Specifications

Product Name Alternative

27kDa, Hsp25-2, MGC107591, cvHsp

UniProt

P35385

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Hspb7 Rabbit Polyclonal Antibody (orb578133) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_038896

Preservative

Lyophilized powder

AA Sequence

TFAHKCQLPEDVDPTSVTSALREDGSLTIRARRNPHTEHVQQTFRTEIKI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Kappa Light Chain (Kap-56), CF740 conjugate, 0.1mg/mL
BNC740859-500 1x 500 µL

Human Kappa Light Chain (Kap-56), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
NCAM1 Antibody
KC-26603-01 50 μL

NCAM1 Antibody

Sign In for Pricing
View Details
NCAM1 Antibody
KC-26603-02 100 µL

NCAM1 Antibody

Sign In for Pricing
View Details
NCAM1 Antibody
KC-26603-03 1 mL

NCAM1 Antibody

Sign In for Pricing
View Details
Stk26 Mouse Gene Knockout Kit (CRISPR)
KN500273 1 Kit

Stk26 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
SNX18 (NM_001102575) Human Over-expression Lysate
LY420160 100 µg

SNX18 (NM_001102575) Human Over-expression Lysate

Sign In for Pricing
View Details