Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HSPB8 Peptide - middle region

HSPB8 Peptide - middle region

Product Specifications

Product Name Alternative

CMT2L, DHMN2, E2IG1, H11, HMN2, HMN2A, HSP22

UniProt

Q9UJY1

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with HSPB8 Rabbit Polyclonal Antibody (orb582602) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_055180

Preservative

Lyophilized powder

AA Sequence

PEELMVKTKDGYVEVSGKHEEKQQEGGIVSKNFTKKIQLPAEVDPVTVFA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Trappc2 sgRNA CRISPR Lentivector set (Mouse)
K4073201 3x 1.0 µg

Trappc2 sgRNA CRISPR Lentivector set (Mouse)

Sign In for Pricing
View Details
Mmu-miR-7039-5p miRNA Inhibitor
orb1869371-01 10 nmol

Mmu-miR-7039-5p miRNA Inhibitor

Sign In for Pricing
View Details
Mmu-miR-7039-5p miRNA Inhibitor
orb1869371-02 20 nmol

Mmu-miR-7039-5p miRNA Inhibitor

Sign In for Pricing
View Details
SGEF (ARHGEF26) (NM_015595) Human Tagged ORF Clone
RC209727 10 µg

SGEF (ARHGEF26) (NM_015595) Human Tagged ORF Clone

Sign In for Pricing
View Details
C-Rel Rabbit Monoclonal Antibody
E46F1305 40 µL

C-Rel Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
6430571L13Rik Protein Vector (Mouse) (pPM-C-His)
PV150217 500 ng

6430571L13Rik Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details