HSPB8 Peptide - middle region
HSPB8 Peptide - middle region
Product Specifications
Product Name Alternative
CMT2L, DHMN2, E2IG1, H11, HMN2, HMN2A, HSP22
UniProt
Q9UJY1
Field of Research
Neuroscience
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with HSPB8 Rabbit Polyclonal Antibody (orb582602) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_055180
Preservative
Lyophilized powder
AA Sequence
PEELMVKTKDGYVEVSGKHEEKQQEGGIVSKNFTKKIQLPAEVDPVTVFA
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
584061-01 20 µg
Complement C1q Subcomponent Subunit A, Recombinant, Human, aa23-245, His-Tag, Myc-Tag
Sign In for Pricing
View Details 584061-02 100 µg
Complement C1q Subcomponent Subunit A, Recombinant, Human, aa23-245, His-Tag, Myc-Tag
Sign In for Pricing
View Details miR-626 (1 x 10^7 IFU/mL - 200 µL) - x2 Tubes
hsa-miR-636 (MIMAT0003306) miRNA expression lentivirus
Sign In for Pricing
View Details 
RK14020 96 Tests
Mouse T-box transcription factor TBX3 (TBX3) ELISA Kit
Sign In for Pricing
View Details 