Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Hspbp1 Peptide - C-terminal region

Hspbp1 Peptide - C-terminal region

Product Specifications

UniProt

Q6IMX7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Hspbp1 Rabbit Polyclonal Antibody (orb582526) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_640354

Preservative

Lyophilized powder

AA Sequence

RLDGFSVLMRAMQQQVQKLKVKSAFLLQNLLVGHPEHKGTLCSMGMVQQL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Texas Red 2’-Propargyl Sulfonamide 4’-Sulfate
TRC-T320205-5MG 5 mg

Texas Red 2’-Propargyl Sulfonamide 4’-Sulfate

Sign In for Pricing
View Details
Frozen Tissue Blocks, Colon
CB608274 1 Block

Frozen Tissue Blocks, Colon

Sign In for Pricing
View Details
GRK2 Rabbit Polyclonal Antibody
AP06430PU-N 100 µg

GRK2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Ankyrin repeat domain containing protein 65 (ANKRD65) Human Gene Knockout Kit (CRISPR)
KN427500 1 Kit

Ankyrin repeat domain containing protein 65 (ANKRD65) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Atg12 (NM_026217) Mouse Tagged ORF Clone
MG200886 10 µg

Atg12 (NM_026217) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Recombinant pTau181 Antibody
RC-025-01 50 μL

Recombinant pTau181 Antibody

Sign In for Pricing
View Details