Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Hspbp1 Peptide - C-terminal region

Hspbp1 Peptide - C-terminal region

Product Specifications

UniProt

Q6IMX7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Hspbp1 Rabbit Polyclonal Antibody (orb582526) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_640354

Preservative

Lyophilized powder

AA Sequence

RLDGFSVLMRAMQQQVQKLKVKSAFLLQNLLVGHPEHKGTLCSMGMVQQL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

D-Luciferin, free acid *CAS#: 2591-17-5*
12503-AAT 1 g

D-Luciferin, free acid *CAS#: 2591-17-5*

Sign In for Pricing
View Details
TrkA (NTRK1) Mouse Monoclonal Antibody [Clone ID: OTI5B6]
CF806413 100 µg

TrkA (NTRK1) Mouse Monoclonal Antibody [Clone ID: OTI5B6]

Sign In for Pricing
View Details
MX2 (NM_002463) Human Over-expression Lysate
LY419297 100 µg

MX2 (NM_002463) Human Over-expression Lysate

Sign In for Pricing
View Details
Tissue FFPE Sections, Ovary: right
CS802137 5x 5 µm

Tissue FFPE Sections, Ovary: right

Sign In for Pricing
View Details
Recombinant CD46 Antibody
RC-6888-01 50 μL

Recombinant CD46 Antibody

Sign In for Pricing
View Details
Recombinant CD46 Antibody
RC-6888-02 100 µL

Recombinant CD46 Antibody

Sign In for Pricing
View Details