Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HTRA1 Peptide - N-terminal region

HTRA1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

ARMD7, HtrA, L56, ORF480, PRSS11

UniProt

Q92743

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with HTRA1 Rabbit Polyclonal Antibody (orb585688) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_002766

Preservative

Lyophilized powder

AA Sequence

DANTYANLCQLRAASRRSERLHRPPVIVLQRGACGQGQEDPNSLRHKYNF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PNPO Human Gene Knockout Kit (CRISPR)
KN400133 1 Kit

PNPO Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CD45RA (PTPRC/818), CF740 conjugate, 0.1mg/mL
BNC740818-500 1x 500 µL

CD45RA (PTPRC/818), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TAG72 Mouse Monoclonal Antibody [Clone ID: B72.3]
AM32243PU-T 20 µg

TAG72 Mouse Monoclonal Antibody [Clone ID: B72.3]

Sign In for Pricing
View Details
1-Amino-3-(9H-carbazol-4-yloxy)-2-propanol
TRC-A611075-500MG 500 mg

1-Amino-3-(9H-carbazol-4-yloxy)-2-propanol

Sign In for Pricing
View Details
DPC 083
TRC-D585490-25MG 25 mg

DPC 083

Sign In for Pricing
View Details
MIR1248 Human qPCR Primer Pair (MI0006383)
HP300068 200 Reactions

MIR1248 Human qPCR Primer Pair (MI0006383)

Sign In for Pricing
View Details