Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HTRA1 Peptide - N-terminal region

HTRA1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

ARMD7, HtrA, L56, ORF480, PRSS11

UniProt

Q92743

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with HTRA1 Rabbit Polyclonal Antibody (orb585688) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_002766

Preservative

Lyophilized powder

AA Sequence

DANTYANLCQLRAASRRSERLHRPPVIVLQRGACGQGQEDPNSLRHKYNF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2-Nitro-5-phenylthioaniline
TRC-N496990-25G 25 g

2-Nitro-5-phenylthioaniline

Sign In for Pricing
View Details
CDHR4 Antibody
KC-43338-01 50 μL

CDHR4 Antibody

Sign In for Pricing
View Details
CDHR4 Antibody
KC-43338-02 100 µL

CDHR4 Antibody

Sign In for Pricing
View Details
CDHR4 Antibody
KC-43338-03 1 mL

CDHR4 Antibody

Sign In for Pricing
View Details
Human HSDL1 activation kit by CRISPRa
GA113235 1 Kit

Human HSDL1 activation kit by CRISPRa

Sign In for Pricing
View Details
Tissue FFPE Sections, Cartilage
CS807293 5x 5 µm

Tissue FFPE Sections, Cartilage

Sign In for Pricing
View Details