Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HYOU1 Peptide - middle region

HYOU1 Peptide - middle region

Product Specifications

Product Name Alternative

DKFZp686N08236, ORP150, Grp170, HSP12A

UniProt

Q9Y4L1

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with HYOU1 Rabbit Polyclonal Antibody (orb579852) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_006380

Preservative

Lyophilized powder

AA Sequence

DREVQYLLNKAKFTKPRPRPKDKNGTRAEPPLNASASDQGEKVIPPAGQT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MTND6P2 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)
LV735430 1.0 µg DNA

MTND6P2 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details
BAALC Human Pre-designed siRNA Set A
HY-RS01329 1 Set

BAALC Human Pre-designed siRNA Set A

Sign In for Pricing
View Details
RT (346-354)
MBS8247018-01 1 mg

RT (346-354)

Sign In for Pricing
View Details
RT (346-354)
MBS8247018-02 5 mg

RT (346-354)

Sign In for Pricing
View Details
RT (346-354)
MBS8247018-03 10 mg

RT (346-354)

Sign In for Pricing
View Details
RT (346-354)
MBS8247018-04 5x 10 mg

RT (346-354)

Sign In for Pricing
View Details