Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IAPP Peptide - N-terminal region

IAPP Peptide - N-terminal region

Product Specifications

Product Name Alternative

AMYLIN, DAP, IAP

UniProt

P10997

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with IAPP Rabbit Polyclonal Antibody (orb578186) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_000406

Preservative

Lyophilized powder

AA Sequence

MGILKLQVFLIVLSVALNHLKATPIESHQVEKRKCNTATCATQRLANFLV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Elab Fluor® 700 Anti-Human CD37 Antibody[IPO-24]
E-AB-F1063M1-01 20 Tests

Elab Fluor® 700 Anti-Human CD37 Antibody[IPO-24]

Sign In for Pricing
View Details
Elab Fluor® 700 Anti-Human CD37 Antibody[IPO-24]
E-AB-F1063M1-02 100 Tests

Elab Fluor® 700 Anti-Human CD37 Antibody[IPO-24]

Sign In for Pricing
View Details
Elab Fluor® 700 Anti-Human CD37 Antibody[IPO-24]
E-AB-F1063M1-03 2x 100 Tests

Elab Fluor® 700 Anti-Human CD37 Antibody[IPO-24]

Sign In for Pricing
View Details
TRIM73 Human Gene Knockout Kit (CRISPR)
KN418773 1 Kit

TRIM73 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human MOGT1 (MOGAT1) activation kit by CRISPRa
GA114582 1 Kit

Human MOGT1 (MOGAT1) activation kit by CRISPRa

Sign In for Pricing
View Details
FYCO1 Mouse Monoclonal Antibody [Clone ID: OTI9D1]
CF809806 100 µg

FYCO1 Mouse Monoclonal Antibody [Clone ID: OTI9D1]

Sign In for Pricing
View Details