Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IAPP Peptide - N-terminal region

IAPP Peptide - N-terminal region

Product Specifications

Product Name Alternative

AMYLIN, DAP, IAP

UniProt

P10997

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with IAPP Rabbit Polyclonal Antibody (orb578186) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_000406

Preservative

Lyophilized powder

AA Sequence

MGILKLQVFLIVLSVALNHLKATPIESHQVEKRKCNTATCATQRLANFLV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Rad18 Antibody
RC-15436-01 50 μL

Recombinant Rad18 Antibody

Sign In for Pricing
View Details
Recombinant Rad18 Antibody
RC-15436-02 100 µL

Recombinant Rad18 Antibody

Sign In for Pricing
View Details
Recombinant Rad18 Antibody
RC-15436-03 1 mL

Recombinant Rad18 Antibody

Sign In for Pricing
View Details
EPO (NM_000799) Human Over-expression Lysate
LY400277 100 µg

EPO (NM_000799) Human Over-expression Lysate

Sign In for Pricing
View Details
TXNDC (TMX1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1C1]
TA506945BM 100 µL

TXNDC (TMX1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1C1]

Sign In for Pricing
View Details
Human ZNF545 (ZFP82) activation kit by CRISPRa
GA117144 1 Kit

Human ZNF545 (ZFP82) activation kit by CRISPRa

Sign In for Pricing
View Details