Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ICAM1 Peptide - N-terminal region

ICAM1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

BB2, CD54, P3.58, ICAM-1, ICAM1

UniProt

P05362

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ICAM1 Rabbit Polyclonal Antibody (orb584229) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_000192

Preservative

Lyophilized powder

AA Sequence

LLPGNNRKVYELSNVQEDSQPMCYSNCPDGQSTAKTFLTVYWTPERVELA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Myoglobin (Muscle Cell Marker) (MB/2105), CF740 conjugate, 0.1mg/mL
BNC742105-500 1x 500 µL

Myoglobin (Muscle Cell Marker) (MB/2105), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tissue FFPE Sections, Kidney
CS714451 5x 5 µm

Tissue FFPE Sections, Kidney

Sign In for Pricing
View Details
PE Anti-Human IL-2 Antibody[MQ1-17H12]
E-AB-F1200D-01 20 Tests

PE Anti-Human IL-2 Antibody[MQ1-17H12]

Sign In for Pricing
View Details
PE Anti-Human IL-2 Antibody[MQ1-17H12]
E-AB-F1200D-02 100 Tests

PE Anti-Human IL-2 Antibody[MQ1-17H12]

Sign In for Pricing
View Details
PE Anti-Human IL-2 Antibody[MQ1-17H12]
E-AB-F1200D-03 2x 100 Tests

PE Anti-Human IL-2 Antibody[MQ1-17H12]

Sign In for Pricing
View Details
Catalase Recombinant Rabbit Monoclonal Antibody [JM11-12]
ET1703-31 100 µL

Catalase Recombinant Rabbit Monoclonal Antibody [JM11-12]

Sign In for Pricing
View Details