Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ICAM1 Peptide - N-terminal region

ICAM1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

BB2, CD54, P3.58, ICAM-1, ICAM1

UniProt

P05362

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ICAM1 Rabbit Polyclonal Antibody (orb584229) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_000192

Preservative

Lyophilized powder

AA Sequence

LLPGNNRKVYELSNVQEDSQPMCYSNCPDGQSTAKTFLTVYWTPERVELA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human FAM171A1 activation kit by CRISPRa
GA116588 1 Kit

Human FAM171A1 activation kit by CRISPRa

Sign In for Pricing
View Details
SSX4 (SSX4B) (NM_001040612) Human Over-expression Lysate
LY421777 100 µg

SSX4 (SSX4B) (NM_001040612) Human Over-expression Lysate

Sign In for Pricing
View Details
NQO1 (NM_001025434) Human Over-expression Lysate
LY422443 100 µg

NQO1 (NM_001025434) Human Over-expression Lysate

Sign In for Pricing
View Details
Ethyl Perfluorooctanoate
TRC-E192630-25MG 25 mg

Ethyl Perfluorooctanoate

Sign In for Pricing
View Details
Human CPLX4 activation kit by CRISPRa
GA117413 1 Kit

Human CPLX4 activation kit by CRISPRa

Sign In for Pricing
View Details
OPHN1 (NM_002547) Human Recombinant Protein
TP314215 20 µg

OPHN1 (NM_002547) Human Recombinant Protein

Sign In for Pricing
View Details