Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ier3ip1 Peptide - N-terminal region

Ier3ip1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

1110057H19Rik, AI644142, AL022842, AL022863, AV026606

UniProt

Q9CR20

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Ier3ip1 Rabbit Polyclonal Antibody (orb579987) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_079685

Preservative

Lyophilized powder

AA Sequence

MQAALLCVNAIAVLHEERFLKNIGWGTDQGIGGFGEEPGIKSQLMNLIRS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DNAJB14 CytoSection
TS404615P5 25 Slides

DNAJB14 CytoSection

Sign In for Pricing
View Details
Mouse Complement component C8 alpha chain ELISA Kit
MBS2887378-01 48 Well

Mouse Complement component C8 alpha chain ELISA Kit

Sign In for Pricing
View Details
Mouse Complement component C8 alpha chain ELISA Kit
MBS2887378-02 96 Well

Mouse Complement component C8 alpha chain ELISA Kit

Sign In for Pricing
View Details
Mouse Complement component C8 alpha chain ELISA Kit
MBS2887378-03 5x 96 Well

Mouse Complement component C8 alpha chain ELISA Kit

Sign In for Pricing
View Details
Mouse Complement component C8 alpha chain ELISA Kit
MBS2887378-04 10x 96 Well

Mouse Complement component C8 alpha chain ELISA Kit

Sign In for Pricing
View Details
Bovine Alpha-Fetoprotein AFP ELISA Kit
BG-BVN10264 1 Each

Bovine Alpha-Fetoprotein AFP ELISA Kit

Sign In for Pricing
View Details