Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IFI44 Peptide - middle region

IFI44 Peptide - middle region

Product Specifications

Product Name Alternative

MTAP44, p44

UniProt

Q8TCB0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with IFI44 Rabbit Polyclonal Antibody (orb579700) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_006408

Preservative

Lyophilized powder

AA Sequence

LIEIERCEPVRSKLEEVQRKLGFALSDISVVSNYSSEWELDPVKDVLILS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KATNA1 Protein Vector (Mouse) (pPM-C-HA)
25302024 500 ng

KATNA1 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
IP3 receptor Recombinant Antibody, AbBy Fluor™ 594 Conjugated
bsm-61555R-BF594-01 20 µL

IP3 receptor Recombinant Antibody, AbBy Fluor™ 594 Conjugated

Sign In for Pricing
View Details
IP3 receptor Recombinant Antibody, AbBy Fluor™ 594 Conjugated
bsm-61555R-BF594-02 100 µL

IP3 receptor Recombinant Antibody, AbBy Fluor™ 594 Conjugated

Sign In for Pricing
View Details
Lentiviral mouse Krt27 shRNA (UAS) - Lentiviral mouse Krt27 shRNA (UAS, RFP) plasmid
GTR15165985 1 Vial

Lentiviral mouse Krt27 shRNA (UAS) - Lentiviral mouse Krt27 shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
Lysozyme antibody
20R-LR006 0.1 mg

Lysozyme antibody

Sign In for Pricing
View Details
In Vivo Grade Recombinant Anti-mouse GITR Rat IgG2a Lambda Monoclonal Antibody (Clone DTA-1)
YR0328-01 1 mg

In Vivo Grade Recombinant Anti-mouse GITR Rat IgG2a Lambda Monoclonal Antibody (Clone DTA-1)

Sign In for Pricing
View Details