Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IFNA13 Peptide - C-terminal region

IFNA13 Peptide - C-terminal region

Product Specifications

Product Name Alternative

IFNA1

UniProt

P01562

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with IFNA13 Rabbit Polyclonal Antibody (orb584773) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_008831

Preservative

Lyophilized powder

AA Sequence

ILAVKKYFRRITLYLTEKKYSPCAWEVVRAEIMRSLSLSTNLQERLRRKE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SCFD1 Mouse Monoclonal Antibody [Clone ID: OTI10D8]
CF808410 100 µg

SCFD1 Mouse Monoclonal Antibody [Clone ID: OTI10D8]

Sign In for Pricing
View Details
DDX3Y Antibody
8C14653-AAT 50 µg

DDX3Y Antibody

Sign In for Pricing
View Details
Recombinant Ube1L/UBA7 Antibody
RC-16572-01 50 μL

Recombinant Ube1L/UBA7 Antibody

Sign In for Pricing
View Details
Recombinant Ube1L/UBA7 Antibody
RC-16572-02 100 µL

Recombinant Ube1L/UBA7 Antibody

Sign In for Pricing
View Details
Recombinant Ube1L/UBA7 Antibody
RC-16572-03 1 mL

Recombinant Ube1L/UBA7 Antibody

Sign In for Pricing
View Details
B3glct Mouse Gene Knockout Kit (CRISPR)
KN501919 1 Kit

B3glct Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details