Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IFNA13 Peptide - C-terminal region

IFNA13 Peptide - C-terminal region

Product Specifications

Product Name Alternative

IFNA1

UniProt

P01562

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with IFNA13 Rabbit Polyclonal Antibody (orb584773) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_008831

Preservative

Lyophilized powder

AA Sequence

ILAVKKYFRRITLYLTEKKYSPCAWEVVRAEIMRSLSLSTNLQERLRRKE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cell Navigator® Cell Plasma Membrane Staining Kit *Red Fluorescence*
22681-AAT 500 Tests

Cell Navigator® Cell Plasma Membrane Staining Kit *Red Fluorescence*

Sign In for Pricing
View Details
3-Aminopyridine
TRC-A629015-50G 50 g

3-Aminopyridine

Sign In for Pricing
View Details
14-3-3 beta/alpha Polyclonal Antibody
E-AB-15795-01 20 µL

14-3-3 beta/alpha Polyclonal Antibody

Sign In for Pricing
View Details
14-3-3 beta/alpha Polyclonal Antibody
E-AB-15795-02 60 µL

14-3-3 beta/alpha Polyclonal Antibody

Sign In for Pricing
View Details
14-3-3 beta/alpha Polyclonal Antibody
E-AB-15795-03 120 µL

14-3-3 beta/alpha Polyclonal Antibody

Sign In for Pricing
View Details
14-3-3 beta/alpha Polyclonal Antibody
E-AB-15795-04 200 µL

14-3-3 beta/alpha Polyclonal Antibody

Sign In for Pricing
View Details