Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IFNB1 Peptide - middle region

IFNB1 Peptide - middle region

Product Specifications

Product Name Alternative

IFB, IFF, IFNB, MGC96956

UniProt

P01574

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with IFNB1 Rabbit Polyclonal Antibody (orb579415) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_002167

Preservative

Lyophilized powder

AA Sequence

NLLANVYHQINHLKTVLEEKLEKEDFTRGKLMSSLHLKRYYGRILHYLKA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF69 Mouse Monoclonal Antibody [Clone ID: OTI4F2]
CF808647 100 µg

ZNF69 Mouse Monoclonal Antibody [Clone ID: OTI4F2]

Sign In for Pricing
View Details
Bodi Fluor FL-C12 [equivalent to BODIPY™ FL C12]
22121-AAT 1 mg

Bodi Fluor FL-C12 [equivalent to BODIPY™ FL C12]

Sign In for Pricing
View Details
Chemerin (RARRES2) (NM_002889) Human Over-expression Lysate
LC401013 20 µg

Chemerin (RARRES2) (NM_002889) Human Over-expression Lysate

Sign In for Pricing
View Details
BRCC2 (BLID) (NM_001001786) Human Over-expression Lysate
LY424226 100 µg

BRCC2 (BLID) (NM_001001786) Human Over-expression Lysate

Sign In for Pricing
View Details
Iduronate 2 suLfatase (IDS) (NM_000202) Human Over-expression Lysate
LY424863 100 µg

Iduronate 2 suLfatase (IDS) (NM_000202) Human Over-expression Lysate

Sign In for Pricing
View Details
TEX11 (NM_031276) Human Recombinant Protein
TP305972M 100 µg

TEX11 (NM_031276) Human Recombinant Protein

Sign In for Pricing
View Details