Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IFNB1 Peptide - middle region

IFNB1 Peptide - middle region

Product Specifications

Product Name Alternative

IFB, IFF, IFNB, MGC96956

UniProt

P01574

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with IFNB1 Rabbit Polyclonal Antibody (orb579415) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_002167

Preservative

Lyophilized powder

AA Sequence

NLLANVYHQINHLKTVLEEKLEKEDFTRGKLMSSLHLKRYYGRILHYLKA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

VASP Human Knockdown Lysate
LY300316 100 µg

VASP Human Knockdown Lysate

Sign In for Pricing
View Details
Nfic Rabbit Polyclonal Antibody
ER1803-46 100 µL

Nfic Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
TRAPPC4 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4B5]
TA505629AM 100 µL

TRAPPC4 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4B5]

Sign In for Pricing
View Details
Anti-Human IgG3 Antibody
KC-086-01 50 μL

Anti-Human IgG3 Antibody

Sign In for Pricing
View Details
Anti-Human IgG3 Antibody
KC-086-02 100 µL

Anti-Human IgG3 Antibody

Sign In for Pricing
View Details
Anti-Human IgG3 Antibody
KC-086-03 1 mL

Anti-Human IgG3 Antibody

Sign In for Pricing
View Details