Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IFT74 Peptide - C-terminal region

IFT74 Peptide - C-terminal region

Product Specifications

Product Name Alternative

CCDC2, CMG-1, CMG1, FLJ22621, MGC111562

UniProt

Q96LB3

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with IFT74 Rabbit Polyclonal Antibody (orb331164) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_079379

Preservative

Lyophilized powder

AA Sequence

WQHLEQNNFAMKEFIATKSQESDYQPIKKNVTKQIAEYNKTIVDALHSTS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LOC100287896 Mouse Monoclonal Antibody [Clone ID: OTI3A9]
CF808344 100 µg

LOC100287896 Mouse Monoclonal Antibody [Clone ID: OTI3A9]

Sign In for Pricing
View Details
TentaGel® S SH
S30134.0.5G 5 g

TentaGel® S SH

Sign In for Pricing
View Details
Polystyrene C4 PHB
HB08016013.100G 100 g

Polystyrene C4 PHB

Sign In for Pricing
View Details
Carcinoembryonic Antigen (CEA) / CD66 (C66/1983R), CF488A conjugate, 0.1mg/mL
BNC881983-100 1x 100 µL

Carcinoembryonic Antigen (CEA) / CD66 (C66/1983R), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PD L2 (PDCD1LG2) Human Gene Knockout Kit (CRISPR)
KN424141 1 Kit

PD L2 (PDCD1LG2) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
KLRA1 (KLRA1P) (NM_006611) Human Recombinant Protein
TP310234 20 µg

KLRA1 (KLRA1P) (NM_006611) Human Recombinant Protein

Sign In for Pricing
View Details