Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IFT74 Peptide - C-terminal region

IFT74 Peptide - C-terminal region

Product Specifications

Product Name Alternative

CCDC2, CMG-1, CMG1, FLJ22621, MGC111562

UniProt

Q96LB3

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with IFT74 Rabbit Polyclonal Antibody (orb331164) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_079379

Preservative

Lyophilized powder

AA Sequence

WQHLEQNNFAMKEFIATKSQESDYQPIKKNVTKQIAEYNKTIVDALHSTS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Elab Fluor® 700 Anti-Mouse CD326/EpCAM Antibody[G8.8]
E-AB-F1181M1-01 50 Tests

Elab Fluor® 700 Anti-Mouse CD326/EpCAM Antibody[G8.8]

Sign In for Pricing
View Details
Elab Fluor® 700 Anti-Mouse CD326/EpCAM Antibody[G8.8]
E-AB-F1181M1-02 100 Tests

Elab Fluor® 700 Anti-Mouse CD326/EpCAM Antibody[G8.8]

Sign In for Pricing
View Details
Elab Fluor® 700 Anti-Mouse CD326/EpCAM Antibody[G8.8]
E-AB-F1181M1-03 2x 100 Tests

Elab Fluor® 700 Anti-Mouse CD326/EpCAM Antibody[G8.8]

Sign In for Pricing
View Details
SDCCAG8 Rabbit Polyclonal Antibody
TA367489 100 µL

SDCCAG8 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Dipyrone-d3
TRC-D492862-1MG 1 mg

Dipyrone-d3

Sign In for Pricing
View Details
Human Calpain 13 (CAPN13) activation kit by CRISPRa
GA114199 1 Kit

Human Calpain 13 (CAPN13) activation kit by CRISPRa

Sign In for Pricing
View Details