Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ift80 Peptide - C-terminal region

Ift80 Peptide - C-terminal region

Product Specifications

Product Name Alternative

4921524P20Rik, Wdr56, mKIAA1374

UniProt

Q8K057

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Ift80 Rabbit Polyclonal Antibody (orb326207) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_080917

Preservative

Lyophilized powder

AA Sequence

PNTIYVDRDILPKTLYERDASEYSKNPHIVSFVGNQVTIRRADGSLVHIS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human TAFA-2 - 1 mg
T354-1mg 1 mg

Recombinant Human TAFA-2 - 1 mg

Sign In for Pricing
View Details
NCALD Protein Vector (Mouse) (pPM-C-HA)
PV204272 500 ng

NCALD Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
ANOS1 Antibody
orb862447 2 mg

ANOS1 Antibody

Sign In for Pricing
View Details
CCR7 Antibody, mAb, Rabbit
A02737-50 50 µL

CCR7 Antibody, mAb, Rabbit

Sign In for Pricing
View Details
ADAM10 siRNA (Mouse)
MBS8235672-01 15 nmol

ADAM10 siRNA (Mouse)

Sign In for Pricing
View Details
ADAM10 siRNA (Mouse)
MBS8235672-02 30 nmol

ADAM10 siRNA (Mouse)

Sign In for Pricing
View Details