Ift80 Peptide - C-terminal region
Ift80 Peptide - C-terminal region
Product Specifications
Product Name Alternative
4921524P20Rik, Wdr56, mKIAA1374
UniProt
Q8K057
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Ift80 Rabbit Polyclonal Antibody (orb326207) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_080917
Preservative
Lyophilized powder
AA Sequence
PNTIYVDRDILPKTLYERDASEYSKNPHIVSFVGNQVTIRRADGSLVHIS
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
C2085-65G-AP 100 µL
Casein Kinase 2 alpha (Casein Kinase II alpha Chain, Casein Kinase II alpha Subunit, Casein Kinase II Subunit alpha, CKII alpha, CKIIa, CKII, CK-II, CK2 alpha, CK2 Catalytic Subunit alpha, Casein Kinase 2 alpha 1 Polypeptide, Casein Kinase II alpha 1 Subunit, CK2A1, CSNK2A1) (AP) discontinued
Sign In for Pricing
View Details MBS3902460-01 0.01 mg
Rabbit anti-Myosin-10 Antibody, Affinity Purified
Sign In for Pricing
View Details MBS3902460-02 0.1 mg
Rabbit anti-Myosin-10 Antibody, Affinity Purified
Sign In for Pricing
View Details MBS3902460-03 5x 0.01 mg
Rabbit anti-Myosin-10 Antibody, Affinity Purified
Sign In for Pricing
View Details