Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ift88 Peptide - N-terminal region

Ift88 Peptide - N-terminal region

Product Specifications

Product Name Alternative

Ttc10

UniProt

D4ACI9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Ift88 Rabbit Polyclonal Antibody (orb582172) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

IHC, WB

NCBI Accession Number

NP_001100736, 157821925, B5WUVB49013

Preservative

Lyophilized powder

AA Sequence

MMENVHLAPETDEDDLYSGFNDYNPAYDTEELENDTGFQQAVRTSHGRRP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Olr802 sgRNA CRISPR Lentivector (Rat) (Target 3)
K7338704 1.0 µg DNA

Olr802 sgRNA CRISPR Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
RAB34 Antibody
OAAB21688-100UL 100 µL

RAB34 Antibody

Sign In for Pricing
View Details
Dimethyl (3,3-difluoro-2-oxoheptyl) phosphonate
010407 10 mg

Dimethyl (3,3-difluoro-2-oxoheptyl) phosphonate

Sign In for Pricing
View Details
TRPV4 Antibody (N-term)
orb1932694-01 50 µL

TRPV4 Antibody (N-term)

Sign In for Pricing
View Details
TRPV4 Antibody (N-term)
orb1932694-02 100 µL

TRPV4 Antibody (N-term)

Sign In for Pricing
View Details
Recombinant Mouse Transcription factor Sp7 (Sp7)
MBS1445489-01 0.02 mg (E-Coli)

Recombinant Mouse Transcription factor Sp7 (Sp7)

Sign In for Pricing
View Details