Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ift88 Peptide - N-terminal region

Ift88 Peptide - N-terminal region

Product Specifications

Product Name Alternative

Ttc10

UniProt

D4ACI9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Ift88 Rabbit Polyclonal Antibody (orb582172) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

IHC, WB

NCBI Accession Number

NP_001100736, 157821925, B5WUVB49013

Preservative

Lyophilized powder

AA Sequence

MMENVHLAPETDEDDLYSGFNDYNPAYDTEELENDTGFQQAVRTSHGRRP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human STAT1 sgRNA gene knockout kit - Lentiviral human STAT1 sgRNA gene knockout kit (25)
GTR15371271 1 Vial

Lentiviral human STAT1 sgRNA gene knockout kit - Lentiviral human STAT1 sgRNA gene knockout kit (25)

Sign In for Pricing
View Details
Pxdn 3'UTR GFP Stable Cell Line
TU167337 1.0 mL

Pxdn 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Vom1r32 sgRNA CRISPR Lentivector set (Rat)
K6282301 3x 1.0 µg

Vom1r32 sgRNA CRISPR Lentivector set (Rat)

Sign In for Pricing
View Details
Anti-Hepatitis C Virus Non-Structural Protein 3 Aptamer
CTApt-027 10 nmol

Anti-Hepatitis C Virus Non-Structural Protein 3 Aptamer

Sign In for Pricing
View Details
Phospho-AMPK beta 1 (Ser108) Rabbit Polyclonal Antibody (PerCP-Cy7)
orb1573991 100 µL

Phospho-AMPK beta 1 (Ser108) Rabbit Polyclonal Antibody (PerCP-Cy7)

Sign In for Pricing
View Details
UPK3A, 19-207aa, Human, His tag, E.coli
E53A04432 50 µg

UPK3A, 19-207aa, Human, His tag, E.coli

Sign In for Pricing
View Details