Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Igf2bp1 Peptide - N-terminal region

Igf2bp1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

AL024068, AW549074, CRD-BP, Crdbp, D030026A21Rik, D11Moh40e, D11Moh45, IMP-1, Neilsen, Zbp1

UniProt

O88477

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Igf2bp1 Rabbit Polyclonal Antibody (orb330970) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_034081

Preservative

Lyophilized powder

AA Sequence

PQLRWEVLDSLLAQYGTVENCEQVNTESETAVVNVTYSNREQTRQAIMKL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tas2r144 Mouse Gene Knockout Kit (CRISPR)
KN517223 1 Kit

Tas2r144 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human CT47A9 activation kit by CRISPRa
GA118900 1 Kit

Human CT47A9 activation kit by CRISPRa

Sign In for Pricing
View Details
Tissue FFPE Sections, Lung
CS702498 5x 5 µm

Tissue FFPE Sections, Lung

Sign In for Pricing
View Details
L-Citrulline
TRC-C535700-1G 1 g

L-Citrulline

Sign In for Pricing
View Details
Zfyve19 Mouse Gene Knockout Kit (CRISPR)
KN520069 1 Kit

Zfyve19 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Primer Panel
HPP6013C 20x 96 Pre-Arrayed Plates

Primer Panel

Sign In for Pricing
View Details