Igf2bp1 Peptide - N-terminal region
Igf2bp1 Peptide - N-terminal region
Product Specifications
Product Name Alternative
AL024068, AW549074, CRD-BP, Crdbp, D030026A21Rik, D11Moh40e, D11Moh45, IMP-1, Neilsen, Zbp1
UniProt
O88477
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Igf2bp1 Rabbit Polyclonal Antibody (orb330970) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_034081
Preservative
Lyophilized powder
AA Sequence
PQLRWEVLDSLLAQYGTVENCEQVNTESETAVVNVTYSNREQTRQAIMKL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC401775-500 1x 500 µL
CFTR (Cystic Fibrosis Transmembrane Conductance Regulator) (CFTR/1775R), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
TRC-E892075-250MG 250 mg
(11Beta)-21-(1-Ethoxyethoxy)-11,17-dihydroxy-pregn-4-ene-3,20-dione
Sign In for Pricing
View Details 
LY419770 100 µg
Actin ReguLatory Protein CAPG (CAPG) (NM_001747) Human Over-expression Lysate
Sign In for Pricing
View Details 
BNC680896-500 1x 500 µL
PDCD1 / PD1 / CD279 (Programmed Cell Death 1) (NAT105), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details