Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Igf2bp3 Peptide - middle region

Igf2bp3 Peptide - middle region

Product Specifications

Product Name Alternative

2610101N11Rik, AA522010, AL022933, AU045931, IMP-3, IMP3, Koc13, MGC61294, Neilsen, mimp3

UniProt

Q9CPN8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Igf2bp3 Rabbit Polyclonal Antibody (orb324884) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_076159

Preservative

Lyophilized powder

AA Sequence

QQNPSPQLRGRRGPGQRGSSRQASPGSVSKQKPCDLPLRLLVPTQFVGAI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-MLK3 (Ser674) Peptide
AF8288-BP 1 mg

Phospho-MLK3 (Ser674) Peptide

Sign In for Pricing
View Details
Mouse Monoclonal Muscarinic Acetylcholine Receptor M3/CHRM3 Antibody (580011) [DyLight 550]
FAB6378L 0.1 mL

Mouse Monoclonal Muscarinic Acetylcholine Receptor M3/CHRM3 Antibody (580011) [DyLight 550]

Sign In for Pricing
View Details
B4GALT2 antibody
70R-6780 100 µL

B4GALT2 antibody

Sign In for Pricing
View Details
4-Chloro-3-isopropylbenzoic acid
OR1099102 1 Each

4-Chloro-3-isopropylbenzoic acid

Sign In for Pricing
View Details
Obscurin, Cytoskeletal Calmodulin And Titin-Interacting RhoGEF (OBSCN) Antibody
abx235956 100 µg

Obscurin, Cytoskeletal Calmodulin And Titin-Interacting RhoGEF (OBSCN) Antibody

Sign In for Pricing
View Details
Glycyltyrosine
orb1909178 1 g

Glycyltyrosine

Sign In for Pricing
View Details