Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Igf2bp3 Peptide - middle region

Igf2bp3 Peptide - middle region

Product Specifications

Product Name Alternative

2610101N11Rik, AA522010, AL022933, AU045931, IMP-3, IMP3, Koc13, MGC61294, Neilsen, mimp3

UniProt

Q9CPN8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Igf2bp3 Rabbit Polyclonal Antibody (orb324884) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_076159

Preservative

Lyophilized powder

AA Sequence

QQNPSPQLRGRRGPGQRGSSRQASPGSVSKQKPCDLPLRLLVPTQFVGAI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Progesterone
553617 1 mg

Progesterone

Sign In for Pricing
View Details
TJP2 Rabbit Polyclonal Antibody (FITC)
orb2121447 100 µL

TJP2 Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
MUL1 Rabbit Polyclonal Antibody (Biotin)
orb445667 100 µL

MUL1 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
UBE2E3 Mouse Monoclonal Antibody [Clone ID: LBI7E8]
AMM14345VCF 100 µg

UBE2E3 Mouse Monoclonal Antibody [Clone ID: LBI7E8]

Sign In for Pricing
View Details
Recombinant Mouse LpPLA2/PLA2G7/PAF-AH Protein, N-His
orb3153225-01 50 µg

Recombinant Mouse LpPLA2/PLA2G7/PAF-AH Protein, N-His

Sign In for Pricing
View Details
Recombinant Mouse LpPLA2/PLA2G7/PAF-AH Protein, N-His
orb3153225-02 100 µg

Recombinant Mouse LpPLA2/PLA2G7/PAF-AH Protein, N-His

Sign In for Pricing
View Details