Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Igfbp5 Peptide - middle region

Igfbp5 Peptide - middle region

Product Specifications

Product Name Alternative

AI256729, AW208790, IGFBP-5, IGFBP-5P

UniProt

Q3UQV0

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Igfbp5 Rabbit Polyclonal Antibody (orb582292) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_034648

Preservative

Lyophilized powder

AA Sequence

IERDSREHEEPTTSEMAEETYSPKVFRPKHTRISELKAEAVKKDRRKKLT

More Discoveries

Explore Other Products

Browse additional items from our catalog

LRRFIP2 Polyclonal Antibody, AbBy Fluor™ 680 Conjugated
bs-12438R-BF680 100 µL

LRRFIP2 Polyclonal Antibody, AbBy Fluor™ 680 Conjugated

Sign In for Pricing
View Details
CD24 Antibody [30-F1] (FITC)
98-980 0.5 mg

CD24 Antibody [30-F1] (FITC)

Sign In for Pricing
View Details
Human KIF5B knockout cell line
ABC-KH7918 1 Vial

Human KIF5B knockout cell line

Sign In for Pricing
View Details
Psmd6-set siRNA/shRNA/RNAi Lentivector (Rat)
38006096 4x 500 ng

Psmd6-set siRNA/shRNA/RNAi Lentivector (Rat)

Sign In for Pricing
View Details
Lentiviral human DGAT2 shRNA (UAS) - Lentiviral human DGAT2 shRNA (UAS, RFP) (25)
GTR15112463 1 Vial

Lentiviral human DGAT2 shRNA (UAS) - Lentiviral human DGAT2 shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
MYBPC1 (NM_001254718) Human Untagged Clone
SC332258 10 µg

MYBPC1 (NM_001254718) Human Untagged Clone

Sign In for Pricing
View Details