Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Igfbp5 Peptide - middle region

Igfbp5 Peptide - middle region

Product Specifications

Product Name Alternative

AI256729, AW208790, IGFBP-5, IGFBP-5P

UniProt

Q3UQV0

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Igfbp5 Rabbit Polyclonal Antibody (orb582292) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_034648

Preservative

Lyophilized powder

AA Sequence

IERDSREHEEPTTSEMAEETYSPKVFRPKHTRISELKAEAVKKDRRKKLT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BCAT2 (Branched Chain Aminotransferase 2, BCAM, BCT2, PP18, BCATM) (MaxLight 650)
MBS6408255-01 0.1 mL

BCAT2 (Branched Chain Aminotransferase 2, BCAM, BCT2, PP18, BCATM) (MaxLight 650)

Sign In for Pricing
View Details
BCAT2 (Branched Chain Aminotransferase 2, BCAM, BCT2, PP18, BCATM) (MaxLight 650)
MBS6408255-02 5x 0.1 mL

BCAT2 (Branched Chain Aminotransferase 2, BCAM, BCT2, PP18, BCATM) (MaxLight 650)

Sign In for Pricing
View Details
Recombinant Mouse IL11 / Interleukin-11, Animal Free & Carrier Free
C-CYP181-100ug 100 µg

Recombinant Mouse IL11 / Interleukin-11, Animal Free & Carrier Free

Sign In for Pricing
View Details
SHF Antibody
GWB-F9872F 0.1 mg

SHF Antibody

Sign In for Pricing
View Details
Oxyresveratrol 3'-O-β-D-glucopyranoside discontinued
371782 5 mg

Oxyresveratrol 3'-O-β-D-glucopyranoside discontinued

Sign In for Pricing
View Details
Obscurin Lentiviral Activation Particles (m2)
sc-436195-LAC-2 200 µL

Obscurin Lentiviral Activation Particles (m2)

Sign In for Pricing
View Details