Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ighmbp2 Peptide - N-terminal region

Ighmbp2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

AEP, Catf1, RIPE3b1, Smbp-2, Smbp2, Smubp2, nmd, sma

UniProt

P40694

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Ighmbp2 Rabbit Polyclonal Antibody (orb324754) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_033238

Preservative

Lyophilized powder

AA Sequence

QLLELERDAEVEERRSWQEHSSLRELQSRGVCLLKLQVSSQRTGLYGQRL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

pOTB7-NDUFA4L2 Plasmid
PVT26095 2 µg

pOTB7-NDUFA4L2 Plasmid

Sign In for Pricing
View Details
LNX1 (NM_001126328) Human Tagged Lenti ORF Clone
RC226115L3 10 µg

LNX1 (NM_001126328) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Herpes Simplex Virus I, II, Glycoprotein D (FITC)
MBS6128105-01 0.1 mL

Herpes Simplex Virus I, II, Glycoprotein D (FITC)

Sign In for Pricing
View Details
Herpes Simplex Virus I, II, Glycoprotein D (FITC)
MBS6128105-02 5x 0.1 mL

Herpes Simplex Virus I, II, Glycoprotein D (FITC)

Sign In for Pricing
View Details
Rat Collagen alpha-1(I) chain,Col1a1 ELISA KIT
ELI-02032r 96 Tests

Rat Collagen alpha-1(I) chain,Col1a1 ELISA KIT

Sign In for Pricing
View Details
ω-Hydroxy-DEET (Standard)
HY-136611R 1 Each

ω-Hydroxy-DEET (Standard)

Sign In for Pricing
View Details