Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ighmbp2 Peptide - N-terminal region

Ighmbp2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

AEP, Catf1, RIPE3b1, Smbp-2, Smbp2, Smubp2, nmd, sma

UniProt

P40694

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Ighmbp2 Rabbit Polyclonal Antibody (orb324754) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_033238

Preservative

Lyophilized powder

AA Sequence

QLLELERDAEVEERRSWQEHSSLRELQSRGVCLLKLQVSSQRTGLYGQRL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GPRASP2 Polyclonal Antibody, FITC Conjugated
bs-15393R-FITC 100 µL

GPRASP2 Polyclonal Antibody, FITC Conjugated

Sign In for Pricing
View Details
NMUR1 siRNA (Mouse)
CRM1663-01 15 nmol

NMUR1 siRNA (Mouse)

Sign In for Pricing
View Details
NMUR1 siRNA (Mouse)
CRM1663-02 30 nmol

NMUR1 siRNA (Mouse)

Sign In for Pricing
View Details
IL-23 Rabbit pAb, BF405 conjugated
orb2539413 100 µL

IL-23 Rabbit pAb, BF405 conjugated

Sign In for Pricing
View Details
Mouse Monoclonal SgK071 Antibody (2B5)
H00169436-M03 0.1 mg

Mouse Monoclonal SgK071 Antibody (2B5)

Sign In for Pricing
View Details
Recombinant human DOK4 protein
ATGP2595-020 20 µg

Recombinant human DOK4 protein

Sign In for Pricing
View Details