IGSF8 Peptide - middle region
IGSF8 Peptide - middle region
Product Specifications
Product Name Alternative
CD316, CD81P3, EWI2, PGRL, EWI-2, KCT-4, LIR-D1
UniProt
Q969P0
Field of Research
Immunology & Inflammation
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with IGSF8 Rabbit Polyclonal Antibody (orb584492) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_443100
Preservative
Lyophilized powder
AA Sequence
LAVEAGAPYAERLAAGELRLGKEGTDRYRMVVGGAQAGDAGTYHCTAAEW
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
GTR15296783 1 Vial
Lentiviral mouse Rhot1 shRNA (UAS) - Lentiviral mouseRhot1 shRNA (UAS, GFP) (25)
Sign In for Pricing
View Details GTR15139043 1 Vial
Lentiviral mouse Rrm1 shRNA (UAS) - Lentiviral mouse Rrm1 shRNA (UAS, RFP) (25)
Sign In for Pricing
View Details 
GTR15256348 1 Vial
Lentiviral mouse Gemin7 shRNA (UAS) - Lentiviral mouse Gemin7 shRNA (UAS, iRFP) plasmid
Sign In for Pricing
View Details